nSMase Antibody

Name nSMase Antibody
Supplier Novus Biologicals
Catalog NBP1-59937
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SMPD2(sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase)) The peptide sequence was selected from the N terminal of SMPD2. Peptide sequence RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQ
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene SMPD2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.