ATP10D Antibody

Name ATP10D Antibody
Supplier Novus Biologicals
Catalog NBP1-59982
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ATP10D(ATPase, class V, type 10D) The peptide sequence was selected from the C terminal of ATP10D. Peptide sequence LFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITLLDA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ATP10D
Conjugate Unconjugated
Supplier Page Shop

Product images