DOLPP1 Antibody

Name DOLPP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59981
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DOLPP1(dolichyl pyrophosphate phosphatase 1) The peptide sequence was selected from the N terminal of DOLPP1. Peptide sequence AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DOLPP1
Conjugate Unconjugated
Supplier Page Shop

Product images