Protocadherin-15 Antibody
| Name | Protocadherin-15 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60065 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PCDH15(protocadherin 15) The peptide sequence was selected from the N terminal of PCDH15. Peptide sequence HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PCDH15 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Protocadherin-15 Antibody [NBP1-60065] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24267_Protocadherin-15-Antibody-Western-Blot-NBP1-60065-img0003.jpg)
Western Blot: Protocadherin-15 Antibody [NBP1-60065] - HepG2 cell lysate, concentration 0.2-1 ug/ml.