OCA2 Antibody

Name OCA2 Antibody
Supplier Novus Biologicals
Catalog NBP1-60052
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OCA2(oculocutaneous albinism II) The peptide sequence was selected from the middle region of OCA2. Peptide sequence LIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OCA2
Conjugate Unconjugated
Supplier Page Shop

Product images