Neurotensin Receptor 1 Antibody
| Name | Neurotensin Receptor 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60045 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Bovine, Dog, Horse, Guinea Pig |
| Antigen | Synthetic peptides corresponding to NTSR1(neurotensin receptor 1 (high affinity)) The peptide sequence was selected from the N terminal of NTSR1. Peptide sequence FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NTSR1 |
| Supplier Page | Shop |
Product images
![Western Blot: Neurotensin Receptor 1 Antibody [NBP1-60045] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/7981_Neurotensin%2520Receptor%25201%2520Antibody-Western%2520Blot-NBP1-60045-img0002.jpg)
Western Blot: Neurotensin Receptor 1 Antibody [NBP1-60045] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.