Name | CYP4V2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-60084 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to CYP4V2(cytochrome P450, family 4, subfamily V, polypeptide 2) The peptide sequence was selected from the middle region of CYP4V2. Peptide sequence RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | CYP4V2 |
Conjugate | Unconjugated |
Supplier Page | Shop |