CYP4V2 Antibody

Name CYP4V2 Antibody
Supplier Novus Biologicals
Catalog NBP1-60084
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CYP4V2(cytochrome P450, family 4, subfamily V, polypeptide 2) The peptide sequence was selected from the middle region of CYP4V2. Peptide sequence RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CYP4V2
Conjugate Unconjugated
Supplier Page Shop

Product images