Sphingomyelin synthase 1 Antibody
| Name | Sphingomyelin synthase 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60081 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SGMS1(sphingomyelin synthase 1) The peptide sequence was selected from the middle region of SGMS1 (NP_671512). Peptide sequence SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SGMS1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Sphingomyelin synthase 1 Antibody [NBP1-60081] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15503_Sphingomyelin-synthase-1-Antibody-Western-Blot-NBP1-60081-img0003.jpg)
Western Blot: Sphingomyelin synthase 1 Antibody [NBP1-60081] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.