ST6GALNAC4 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-62417
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to ST6GALNAC4(ST6 -N-acetylgalactosaminide alpha-2,6-sialyltransferase 4) The peptide sequence was selected from the middle region of ST6GALNAC4. Peptide sequence QLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLST
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ST6GALNAC4
• Conjugate: Unconjugated