AOC2 Antibody

Name AOC2 Antibody
Supplier Novus Biologicals
Catalog NBP1-62442
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to AOC2(amine oxidase, copper containing 2 (retina-specific)) The peptide sequence was selected from the middle region of AOC2 (NP_033720). Peptide sequence QATMVDIHILVGKGAVQLLPGAVCVFEEAQGLPLRRHHNYLQNHFYGGLA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AOC2
Conjugate Unconjugated
Supplier Page Shop

Product images