Prostaglandin I2 Synthase Antibody

Name Prostaglandin I2 Synthase Antibody
Supplier Novus Biologicals
Catalog NBP1-62390
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PTGIS(prostaglandin I2 (prostacyclin) synthase) The peptide sequence was selected from the middle region of PTGIS. Peptide sequence EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PTGIS
Conjugate Unconjugated
Supplier Page Shop

Product images