Hephaestin Antibody
| Name | Hephaestin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-62496 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Horse, Guinea Pig, Rabbit |
| Antigen | Synthetic peptides corresponding to HEPH(hephaestin) The peptide sequence was selected from the N terminal of HEPH. Peptide sequence MHAINGFVFGNLPELNMCAQKRVAWHLFGMGNEIDVHTAFFHGQMLTTRG. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HEPH |
| Supplier Page | Shop |
Product images
![Western Blot: Hephaestin Antibody [NBP1-62496] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8007_Hephaestin%2520Antibody-Western%2520Blot-NBP1-62496-img0003.jpg)
Western Blot: Hephaestin Antibody [NBP1-62496] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.