AOC2 Antibody

Name AOC2 Antibody
Supplier Novus Biologicals
Catalog NBP1-62443
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Pig, Bovine, Dog, Rabbit
Antigen Synthetic peptides corresponding to AOC2(amine oxidase, copper containing 2 (retina-specific)) The peptide sequence was selected from the middle region of AOC2. Peptide sequence AEDIPNTVTLGNRVGFLLRPYNFFDEDPSIFSPGSVYFEKGQDAGLCSIN.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene AOC2
Supplier Page Shop

Product images