CHAC1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57685
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to CHAC1(ChaC, cation transport regulator homolog 1 (E. coli)) The peptide sequence was selected from the C terminal of CHAC1. Peptide sequence TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: CHAC1
• Conjugate: Unconjugated