OVCA1 Antibody

Name OVCA1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57711
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit, Yeast, Zebrafish
Antigen Synthetic peptides corresponding to DPH1 (DPH1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of DPH1)(50ug). Peptide sequence NQIPPEILKNPQLQAAIRVLPSNYNFEIPKTIWRIQQAQAKKVALQMPEG.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene DPH1
Supplier Page Shop

Product images