PC6 Antibody

Name PC6 Antibody
Supplier Novus Biologicals
Catalog NBP1-57908
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PCSK5(proprotein convertase subtilisin/kexin type 5) The peptide sequence was selected from the middle region of PCSK5. Peptide sequence CAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDIS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PCSK5
Conjugate Unconjugated
Supplier Page Shop

Product images