Name | PC6 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57908 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PCSK5(proprotein convertase subtilisin/kexin type 5) The peptide sequence was selected from the middle region of PCSK5. Peptide sequence CAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDIS. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | PCSK5 |
Conjugate | Unconjugated |
Supplier Page | Shop |