KIAA1199 Antibody

Name KIAA1199 Antibody
Supplier Novus Biologicals
Catalog NBP1-58029
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KIAA1199(KIAA1199) The peptide sequence was selected from the middle region of KIAA1199. Peptide sequence PFLSIISARYSPHQDADPLKPREPAIIRHFIAYKNQDHGAWLRGGDVWLD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CEMIP
Conjugate Unconjugated
Supplier Page Shop

Product images