B3GALNT2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57930
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to B3GALNT2(beta-1,3-N-acetylgalactosaminyltransferase 2) The peptide sequence was selected from the middle region of B3GALNT2. Peptide sequence PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: B3GALNT2
• Conjugate: Unconjugated