CCNY Antibody

Name CCNY Antibody
Supplier Novus Biologicals
Catalog NBP1-58071
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CCNY(cyclin Y) The peptide sequence was selected from the middle region of CCNY. Peptide sequence DENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CCNY
Conjugate Unconjugated
Supplier Page Shop

Product images