Viperin Antibody

Name Viperin Antibody
Supplier Novus Biologicals
Catalog NBP1-58062
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RSAD2(radical S-adenosyl methionine domain containing 2) The peptide sequence was selected from the N terminal of RSAD2. Peptide sequence PLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLP.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene RSAD2
Conjugate Unconjugated
Supplier Page Shop

Product images