POFUT2 Antibody

Name POFUT2 Antibody
Supplier Novus Biologicals
Catalog NBP1-58054
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to POFUT2(protein O-fucosyltransferase 2) The peptide sequence was selected from the N terminal of POFUT2. Peptide sequence GAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene POFUT2
Conjugate Unconjugated
Supplier Page Shop

Product images