DHRS9 Antibody

Name DHRS9 Antibody
Supplier Novus Biologicals
Catalog NBP1-58043
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DHRS9(dehydrogenase/reductase (SDR family) member 9) The peptide sequence was selected from the middle region of DHRS9. Peptide sequence DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DHRS9
Conjugate Unconjugated
Supplier Page Shop

Product images