DNA Primase small subunit Antibody

Name DNA Primase small subunit Antibody
Supplier Novus Biologicals
Catalog NBP1-58184
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PRIM1(primase, polypeptide 1, 49kDa) The peptide sequence was selected from the N terminal of PRIM1. Peptide sequence SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene PRIM1
Conjugate Unconjugated
Supplier Page Shop

Product images