Name | DNA Primase small subunit Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-58184 |
Prices | $299.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PRIM1(primase, polypeptide 1, 49kDa) The peptide sequence was selected from the N terminal of PRIM1. Peptide sequence SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | PRIM1 |
Conjugate | Unconjugated |
Supplier Page | Shop |