DNA polymerase sigma Antibody
| Name | DNA polymerase sigma Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58159 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to POLS(polymerase (DNA directed) sigma) The peptide sequence was selected from the N terminal of POLS. Peptide sequence VVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PAPD7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DNA polymerase sigma Antibody [NBP1-58159] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16697_DNA%2520polymerase%2520sigma%2520Antibody-Western%2520Blot-NBP1-58159-img0002.jpg)
Western Blot: DNA polymerase sigma Antibody [NBP1-58159] - HepG2 cell lysate, concentration 0.2-1 ug/ml.