PLC-beta 1 Antibody

Name PLC-beta 1 Antibody
Supplier Novus Biologicals
Catalog NBP1-58257
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PLCB1(phospholipase C, beta 1 (phosphoinositide-specific)) The peptide sequence was selected from the middle region of PLCB1. Peptide sequence EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PLCB1
Conjugate Unconjugated
Supplier Page Shop

Product images