MCTS1 Antibody

Name MCTS1 Antibody
Supplier Novus Biologicals
Catalog NBP1-58236
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MCTS1(malignant T cell amplified sequence 1) The peptide sequence was selected from the N terminal of MCTS1. Peptide sequence MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MCTS1
Conjugate Unconjugated
Supplier Page Shop

Product images