KCC1/SLC12A4 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-58293
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SLC12A4(solute carrier family 12 (potassium/chloride transporters), member 4) The peptide sequence was selected from the N terminal of SLC12A4. Peptide sequence MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGN
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SLC12A4
• Conjugate: Unconjugated