LZTS2 Antibody

Name LZTS2 Antibody
Supplier Novus Biologicals
Catalog NBP1-58275
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Goat, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to LZTS2(leucine zipper, putative tumor suppressor 2) The peptide sequence was selected from the N terminal of LZTS2. Peptide sequence EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene LZTS2
Supplier Page Shop

Product images