WRCH1 Antibody

Name WRCH1 Antibody
Supplier Novus Biologicals
Catalog NBP1-58350
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RHOU(ras homolog gene family, member U) The peptide sequence was selected from the C terminal of RHOU. Peptide sequence LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RHOU
Conjugate Unconjugated
Supplier Page Shop

Product images