PATJ Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-58843
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to INADL(InaD-like (Drosophila)) The peptide sequence was selected from the N terminal of INADL. Peptide sequence EVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSG.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: INADL
• Conjugate: Unconjugated