SH2D3C Antibody

Name SH2D3C Antibody
Supplier Novus Biologicals
Catalog NBP1-58841
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SH2D3C(SH2 domain containing 3C) The peptide sequence was selected from the N terminal of SH2D3C. Peptide sequence AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SH2D3C
Conjugate Unconjugated
Supplier Page Shop

Product images