SNX5 Antibody
| Name | SNX5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58340 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SNX5(sorting nexin 5) The peptide sequence was selected from the N terminal of SNX5. Peptide sequence FVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEF. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SNX5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SNX5 Antibody [NBP1-58340] - Human, Mouse.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6939_SNX5-Antibody-Western-Blot-NBP1-58340-img0003.jpg)
![Western Blot: SNX5 Antibody [NBP1-58340] - 293T cells lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6940_SNX5-Antibody-Western-Blot-NBP1-58340-img0002.jpg)