RGS3 Antibody

Name RGS3 Antibody
Supplier Novus Biologicals
Catalog NBP1-58312
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the C terminal of human RGS3 Peptide sequence KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RGS3
Conjugate Unconjugated
Supplier Page Shop

Product images