GNAQ Antibody

Name GNAQ Antibody
Supplier Novus Biologicals
Catalog NBP1-58311
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GNAQ(guanine nucleotide binding protein (G protein), q polypeptide) The peptide sequence was selected from the N terminal of GNAQ. Peptide sequence DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GNAQ
Conjugate Unconjugated
Supplier Page Shop

Product images