Name | GNAQ Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-58311 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to GNAQ(guanine nucleotide binding protein (G protein), q polypeptide) The peptide sequence was selected from the N terminal of GNAQ. Peptide sequence DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | GNAQ |
Conjugate | Unconjugated |
Supplier Page | Shop |