PLSCR3 Antibody
| Name | PLSCR3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52866 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PLSCR3(phospholipid scramblase 3) The peptide sequence was selected from the middle region of PLSCR3. Peptide sequence GCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PLSCR3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: PLSCR3 Antibody [NBP1-52866] - Analysis of PLSCR3 in mouse lung tissues using PLSCR3 antibody. Tissues were untreated or treated with 100 ng/ml LPS. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12591_PLSCR3-Antibody-Western-Blot-NBP1-52866-img0003.jpg)
![Western Blot: PLSCR3 Antibody [NBP1-52866] - Human Placenta lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12592_PLSCR3%2520Antibody-Western%2520Blot-NBP1-52866-img0002.jpg)