Name | PSMG1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-52843 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Horse, Rabbit |
Antigen | Synthetic peptides corresponding to PSMG1(proteasome (prosome, macropain) assembly chaperone 1) The peptide sequence was selected from the middle region of PSMG1. Peptide sequence VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | PSMG1 |
Supplier Page | Shop |