PSMG1 Antibody

Name PSMG1 Antibody
Supplier Novus Biologicals
Catalog NBP1-52843
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Rabbit
Antigen Synthetic peptides corresponding to PSMG1(proteasome (prosome, macropain) assembly chaperone 1) The peptide sequence was selected from the middle region of PSMG1. Peptide sequence VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene PSMG1
Supplier Page Shop

Product images