Septin-6 Antibody

Name Septin-6 Antibody
Supplier Novus Biologicals
Catalog NBP1-52840
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SEPT6(septin 6) The peptide sequence was selected from the N terminal of 40427. Peptide sequence TGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SEPT6
Conjugate Unconjugated
Supplier Page Shop

Product images