HERC4 Antibody

Name HERC4 Antibody
Supplier Novus Biologicals
Catalog NBP1-53020
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HERC4(hect domain and RLD 4) The peptide sequence was selected from the n terminal of HERC4. Peptide sequence MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HERC4
Conjugate Unconjugated
Supplier Page Shop

Product images