Histone H2AY/macroH2A.1 Antibody
| Name | Histone H2AY/macroH2A.1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53003 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to H2AFY(H2A histone family, member Y) The peptide sequence was selected from the N terminal of H2AFY. Peptide sequence HPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | H2AFY |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Histone H2AY/macroH2A.1 Antibody [NBP1-53003] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6853_Histone-H2AY-macroH2A.1-Antibody-Western-Blot-NBP1-53003-img0002.jpg)
Western Blot: Histone H2AY/macroH2A.1 Antibody [NBP1-53003] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
![Western Blot: Histone H2AY/macroH2A.1 Antibody [NBP1-53003] - MCF7, Antibody Dilution: 1.0 ug/ml H2AFY is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6854_Histone%2520H2AY-macroH2A.1%2520Antibody-Western%2520Blot-NBP1-53003-img0003.jpg)
Western Blot: Histone H2AY/macroH2A.1 Antibody [NBP1-53003] - MCF7, Antibody Dilution: 1.0 ug/ml H2AFY is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.