PIN4 Antibody

Name PIN4 Antibody
Supplier Novus Biologicals
Catalog NBP1-52995
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PIN4(protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)) The peptide sequence was selected from the middle region of PIN4. Peptide sequence LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTK
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PIN4
Conjugate Unconjugated
Supplier Page Shop

Product images