Name | KPNA5 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-52978 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to KPNA5(karyopherin alpha 5 (importin alpha 6)) The peptide sequence was selected from the C terminal of KPNA5. Peptide sequence TVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIE. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | KPNA5 |
Conjugate | Unconjugated |
Supplier Page | Shop |