FRS3 Antibody

Name FRS3 Antibody
Supplier Novus Biologicals
Catalog NBP1-52962
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FRS3(fibroblast growth factor receptor substrate 3) The peptide sequence was selected from the middle region of FRS3. Peptide sequence GFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FRS3
Conjugate Unconjugated
Supplier Page Shop

Product images