Name | TNPO2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-52896 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish |
Antigen | Synthetic peptides corresponding to TNPO2(transportin 2 (importin 3, karyopherin beta 2b)) The peptide sequence was selected from the C terminal of TNPO2. Peptide sequence LVQKTLAQAMMYTQHPEQYEAPDKDFMIVALDLLSGLAEGLGGHVEQLVA. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | TNPO2 |
Supplier Page | Shop |