NSUN2 Antibody

Name NSUN2 Antibody
Supplier Novus Biologicals
Catalog NBP1-53052
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NSUN2(NOL1/NOP2/Sun domain family, member 2) The peptide sequence was selected from the C terminal of NSUN2. Peptide sequence FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NSUN2
Conjugate Unconjugated
Supplier Page Shop

Product images