WWP2 Antibody

Name WWP2 Antibody
Supplier Novus Biologicals
Catalog NBP1-53089
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to WWP2(WW domain containing E3 ubiquitin protein ligase 2) The peptide sequence was selected from the middle region of WWP2. Peptide sequence SSASTDHDPLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMIQEP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene WWP2
Conjugate Unconjugated
Supplier Page Shop

Product images