EIF2G Antibody

Name EIF2G Antibody
Supplier Novus Biologicals
Catalog NBP1-53087
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to EIF2G (eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa) The peptide sequence was selected from the N terminal of EIF2G. Peptide sequence LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCP
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene EIF2S3
Conjugate Unconjugated
Supplier Page Shop

Product images