ACD Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-53154
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to ACD(adrenocortical dysplasia homolog (mouse)) The peptide sequence was selected from the middle region of ACD (NP_001075955). Peptide sequence KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ACD
• Conjugate: Unconjugated