Myosin 1E Antibody
| Name | Myosin 1E Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53151 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MYO1E(myosin IE) The peptide sequence was selected from the middle region of MYO1E (NP_004989). Peptide sequence PKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGR. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MYO1E |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Myosin 1E Antibody [NBP1-53151] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15775_Myosin-1E-Antibody-Western-Blot-NBP1-53151-img0003.jpg)
Western Blot: Myosin 1E Antibody [NBP1-53151] - HepG2 cell lysate, concentration 0.2-1 ug/ml.