DTX2 Antibody

Name DTX2 Antibody
Supplier Novus Biologicals
Catalog NBP1-53119
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DTX2(deltex homolog 2 (Drosophila)) The peptide sequence was selected from the C terminal of DTX2. Peptide sequence EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DTX2
Conjugate Unconjugated
Supplier Page Shop

Product images