Nexilin Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-53226
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to NEXN(nexilin (F actin binding protein)) The peptide sequence was selected from the middle region of NEXN. Peptide sequence EELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEDEENQDTAKI.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: NEXN
• Conjugate: Unconjugated